PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G22010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 252aa    MW: 28131.2 Da    PI: 6.3644
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G22010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.41.1e-301871255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     pr+rWt+eLH++Fveave LGG+++AtPk+il+lm+vkg++++h+kSHLQ+YR+
  OPUNC06G22010.1 18 PRMRWTEELHRQFVEAVECLGGQDEATPKRILQLMGVKGVSISHIKSHLQMYRS 71
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-291472IPR009057Homeodomain-like
PROSITE profilePS5129412.8861474IPR017930Myb domain
SuperFamilySSF466898.06E-171871IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-241871IPR006447Myb domain, plants
PfamPF002496.6E-91970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGGFERRGVR QYNRSEVPRM RWTEELHRQF VEAVECLGGQ DEATPKRILQ LMGVKGVSIS  60
HIKSHLQMYR SGSSNSNHPV SLQKLTSATV NNINKRAFVN SEDRCIYASE DRNTASSDKN  120
TYTILRCGRS SMPSIEEIFR NWEQSRGRLL PWNSNVITTE QATRASRQTS NYTKPLKQQT  180
DCDLTLSIGL WEDAAGSDAD GSSTISEEVA APSREEAFVS SADDHFAAAA KESNMLTTDL  240
NLDLTISSSW LS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4067630.0CU406763.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C005B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641452.11e-173PREDICTED: probable transcription factor KAN3
TrEMBLA0A0E0LEI80.0A0A0E0LEI8_ORYPU; Uncharacterized protein
STRINGBGIOSGA023442-PA1e-172(Oryza sativa Indica Group)
STRINGLOC_Os06g45890.11e-172(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54933758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.11e-28G2-like family protein